$FL2@(#) SPSS DATA FILE MS Windows Release 12.0 spssio32.dll +Y@03 May 0417:33:50 ID subject id 8@MISS SAMP130 CHECK check INTRWCONinterview consent 8@RACE race8@CDI1 cdi1-dead 8@CDI2 cdi2-anxious8@CDI3 cdi3-annoyed8@CDI4 cdi4-powerless 8@CDI5 cdi5-alivenotint8@CDI6 cdi6-palpitations 8@CDI7 cdi7-nosexint 8@CDI8 cdi8-stupid 8@CDI9 cdi9-indecisive 8@CDI10 cdi10-wantdie 8@CDI11 cdi11-noenergy 8@CDI12 cdi12-voiceweak 8@CDI13 cdi13-sleepless 8@CDI14 cdi14-donothing 8@CDI15 cdi15-unhappy 8@CDI16 cdi16-distressful 8@CDI17 cdi-17nothingint8@CDI18 cdi18-nervous 8@CDI19 cdi19-noappetite8@CDI20 cdi20-slimmer 8@CDITOTALBDI1 bdi1-sad8@BDI2 bdi2-discouraged8@BDI3 bdi3-failure8@BDI4 bdi4-satisfaction 8@BDI5 bdi5-guilty 8@BDI6 bdi6-punished 8@BDI7 bdi7-disappointed 8@BDI8 bdi8-selfcritical 8@BDI9 bdi9-suicide8@BDI10 bdi10-cry 8@BDI11 bdi11-irritated 8@BDI12 bdi12-lostint 8@BDI13 bdi13-decisions 8@BDI14 bdi14-appearance8@BDI15 bdi15-work 8@BDI16 bdi16-sleep 8@BDI17 bdi17-tired 8@BDI18 bdi18-appetite 8@BDI19 bdi19-weight8@BDI19A bdi19a-eatless 8@BDI20 bdi20-health8@BDI21 bdi21-sex 8@BDITOTALBDI2TOTABDI2_01 BDI2_02 BDI2_03 BDI2_04 BDI2_05 BDI2_06 BDI2_07 BDI2_08 BDI2_09 BDI2_10 BDI2_11 BDI2_12 BDI2_13 BDI2_14 BDI2_15 BDI2_16 BDI2_17 BDI2_18 BDI2_19 BDI2_20 BDI2_21 AGE age 8@AGERANGEAge broken down into ranges GENDER gender 8@COUNTRY country born8@IMMIYEARimmigration year8@USLENGTHYears lived in the US GENERATNgeneration status 8@ETHNIC1 ethnicity1 8@ETHNIC2 ethnicity2 8@ETHNIC3 ethnicity3 8@ETHNICM1ethnicity1 mom 8@ETHNICM2ethnicity2 mom 8@ETHNICM3ethnicity3 mom 8@RELM relationship mom8@OCCMO mom's occupation8@EDUCM mom's education 8@ETHNICF1ethnicity1 dad 8@ETHNICF2ethnicity2 dad 8@ETHNICF3ethnicity3 dad 8@RELF relationship dad8@OCCF dad's occupation8@EDUCF dad's education 8@ETHDAD1 ethnicity1 bio-dad 8@ETHDAD2 ethnicity2 bio-dad 8@ETHMOM1 ethnicity1 bio-mom 8@ETHMOM2 ethnicity2 bio-mom 8@MARITAL1parent's rel- unmarried 8@MARITAL2parent's rel-married8@MARITAL3parent's rel-divorced 8@MARITAL4parent's rel-widowed8@MARITAL5parent's rel-separated 8@MARITAL6parent's rel-remarried 8@INFLUEN influencial person 8@TRADMOM mother traditional 8@WESTMOM mother western 8@TRADDAD father traditional 8@WESTDAD father western 8@SIB1 oldest child8@SIB2 second oldest child 8@SIB3 third oldest child 8@SIB4 fourth oldest child 8@SIB5 fifth oldest child 8@BIRTHORD birth order 8@RESALONE resides alone 8@RESPAR resides parents 8@RESSIG resides sig other 8@RESROOM resides roommate8@RESOTHER resides other 8@MARITAL marital status 8@ETHPART1ethnicity1 partner 8@ETHPART2ethnicity2 partner 8@ETHPART3ethnicity3 partner 8@CHILDRENnumber of children 8@EDUC education 8@COUNTRY1country1 lived 8@CNTRY1YRyears in country 1 8@COUNTRY2country2 lived 8@CNTRY2YRyears in country 2 8@COUNTRY3country3 lived 8@CNTRY3YRyears in country 3 8@COUNTRY4country4 lived 8@CNTRY4YRyears in country 4 8@LSCHOOL language school 8@LSCHYRS yrs in language sch 8@INCOME income 8@OCCSELF occupation 8@RELPRAC practice religion 8@TYPEREL religion type 8@NEIGHBORneighbors' ethnicity8@IMMCAUSEimmigration cause 8@IMMTYPE immigration type8@SPONREL sponsor relative8@SPONFRD sponsor friend 8@SPONSCH sponsor church 8@SPONSPA sponsor pol asylum 8@SPONSOTH sponsor other 8@INCOMEUS income US 8@FRIENDS friends 8@DEPHX depression history 8@MHHELP mental health help 8@MHTYPE1 help friends8@MHTYPE2 help social services8@MHTYPE3 help religion 8@MHTYPE4 help doctor 8@MHTYPE5 help mh professional8@MHTYPE6 help other 8@PSYHOSP psychatric hospital 8@DISCRM48personal discrimination 8@DISCRM49friend/family discrimination8@DAILY50Afirst language a8@DAILY50Bfirst language b8@DAILY50Cfirst language c8@DAILY50Dfirst language d8@DAILY51Aunderstand lang a 8@DAILY51Bunderstand lang b 8@DAILY51Cunderstand lang c 8@DAILY51Dunderstand lang d 8@DAILY52Aspeak language a8@DAILY52Bspeak language b8@DAILY52Cspeak language c8@DAILY52Dspeak language d8@DAILY53Aparents/grnd speak a8@DAILY53Bparents/grnd speak b8@DAILY53Cparents/grnd speak c8@DAILY53Dparents/grnd speak d8@DAILY54Awith family speak a 8@DAILY54Bwith family speak b 8@DAILY54Cwith family speak c 8@DAILY54Dwith family speak d 8@DAILY55Awith friends speak a8@DAILY55Bwith friends speak b8@DAILY55Cwith friends speak c8@DAILY55Dwith friends speak d8@DAILY56Asocial act speak a 8@DAILY56Bsocial act speak b 8@DAILY56Csocial act speak c 8@DAILY56Dsocial act speak d 8@DAILY57Aprimary job speak a 8@DAILY57Bprimary job speak b 8@DAILY57Cprimary job speak c 8@DAILY57Dprimary job speak d 8@DAILY58Ausually think in a 8@DAILY58Busually think in b 8@DAILY58Cusually think in c 8@DAILY58Dusually think in d 8@DAILY59Ausually write in a 8@DAILY59Busually write in b 8@DAILY59Cusually write in c 8@DAILY59Dusually write in d 8@DAILY60Aprefer write in a 8@DAILY60Bprefer write in b 8@DAILY60Cprefer write in c 8@DAILY60Dprefer write in d 8@DAILY61Ausually read in a 8@DAILY61Busually read in b 8@DAILY61Cusually read in c 8@DAILY61Dusually read in d 8@DAILY62Aprefer read in a8@DAILY62Bprefer read in b8@DAILY62Cprefer read in c8@DAILY62Dprefer read in d8@DAILY63Ausually speak in a 8@DAILY63Busually speak in b 8@DAILY63Cusually speak in c 8@DAILY63Dusually speak in d 8@DAILY64Aprefer speak in a 8@DAILY64Bprefer speak in b 8@DAILY64Cprefer speak in c 8@DAILY64Dprefer speak in d 8@ETHNICITethnicity 65-78 8@BKSAVAILethnic books available 8@BKSUSE ethnic books read 8@NEWSAVL ethnic news avail 8@NEWSUSE ethnic news read8@TVAVAIL ethnic tv available 8@TVUSE ethnic tv watched 8@MOVIEAVLethnic movies available 8@MOVIEUSEethnic movies watched 8@RADIOAVLethnic radio available 8@RADIOUSEethnic radio use8@RESTRAVLethnic restaurants avail8@RESTRUSEethnic restaurants used 8@STOREAVLethnic stores available 8@ETHNEAT ethnic food eaten 8@FAMRANK family ranking 8@SOCRANK social ranking 8@WORKRANK work ranking8@MYETHNICmy ethnic group 8@SOCIALA social rel A8@SOCIALW social rel W8@WORKA work env A 8@WORKW work env W 8@DAILYA daily act A 8@DAILYW daily act W 8@FAMILYA family rel A8@FAMILYW family rel W8@IDENTA identify A 8@IDENTW identify W 8@MPBI1 m-voice 8@MPBI2 m-helped8@MPBI3 m-letmedo 8@MPBI4 m-emotcold 8@MPBI5 m-understandprob8@MPBI6 m-affectionate 8@MPBI7 m-decisions 8@MPBI8 m-wantgrowup8@MPBI9 m-control 8@MPBI10 m-privacy 8@MPBI11 m-talking 8@MPBI12 m-smiled8@MPBI13 m-babyme8@MPBI14 m-understandneed8@MPBI15 m-decide8@MPBI16 m-wanted8@MPBI17 m-feelbet 8@MPBI18 m-talked8@MPBI19 m-dependent 8@MPBI20 m-lookafterself 8@MPBI21 m-freedom 8@MPBI22 m-goout 8@MPBI23 m-overprotective8@MPBI24 m-praised 8@MPBI25 m-dress 8@FPBI1 f-voice 8@FPBI2 f-helped8@FPBI3 f-letmedo 8@FPBI4 f-emotcold 8@FPBI5 f-understandprob8@FPBI6 f-affectionate 8@FPBI7 f-decisions 8@FPBI8 f-wantgrowup8@FPBI9 f-control 8@FPBI10 f-privacy 8@FPBI11 f-talking 8@FPBI12 f-smiled8@FPBI13 f-babyme8@FPBI14 f-understandneed8@FPBI15 f-decide8@FPBI16 f-wanted8@FPBI17 f-feelbet 8@FPBI18 f-talked8@FPBI19 f-dependent 8@FPBI20 f-lookafterself 8@FPBI21 f-freedom 8@FPBI22 f-goout 8@FPBI23 f-overprotective8@FPBI24 f-praised 8@FPBI25 f-dress 8@IIP1 trust others8@IIP2 say no 8@IIP3 join groups 8@IIP4 keep things private 8@IIP5 say what want 8@IIP6 don't bother me 8@IIP7 introduce myself8@IIP8 confront people 8@IIP9 be assertive8@IIP10 make friends8@IIP11 express admiration 8@IIP12 have a dependent8@IIP13 disagree with others8@IIP14 tell people I'm angry 8@IIP15 make long-term commitment 8@IIP16 stick to point of view 8@IIP17 be another's boss 8@IIP18 do what another wants 8@IIP19 get along with authority8@IIP20 be aggressive 8@IIP21 compete 8@IIP22 make demands8@IIP23 socialize 8@IIP24 get out of relationship 8@IIP25 take charge 8@IIP26 show affection 8@IIP27 feel comfortable around others 8@IIP28 get along 8@IIP29 understand other's p.o.v. 8@IIP30 tell personal things8@IIP31 believe I am loveable 8@IIP32 express feelings8@IIP33 be firm 8@IIP34 love someone8@IIP35 be competitive 8@IIP36 set limits 8@IIP37 be honest 8@IIP38 be supportive 8@IIP39 feel close 8@IIP40 care about others' problems 8@IIP41 argue 8@IIP42 relax with others 8@IIP43 feel superior 8@IIP44 become sexually aroused 8@IIP45 deserve other's affection 8@IIP46 keep up friendship 8@IIP47 spend time alone8@IIP48 give a gift 8@IIP49 love and anger 8@IIP50 work with one I don't like 8@IIP51 set goals alone 8@IIP52 accept authority8@IIP53 feel good about winning 8@IIP54 ignore criticism8@IIP55 feel separate 8@IIP56 be more successful 8@IIP57 be competent parent 8@IIP58 be angry at s/o I like 8@IIP59 respond sexually8@IIP60 accept praise 8@IIP61 put other's needs first 8@IIP62 give credit 8@IIP63 stay out of others' buisness8@IIP64 take instructions 8@IIP65 !feel good about other's happiness 8@IIP66 get over loss 8@IIP67 invite others socially 8@IIP68 feel angry 8@IIP69 give criticism 8@IIP70 experience sexual satisfaction 8@IIP71 tell feelings 8@IIP72 forgive 8@IIP73 put myself first8@IIP74 be assertive & not worry8@IIP75 be involved 8@IIP76 work for myself 8@IIP77 be close8@IIP78 be self-confident 8@IIP79 too much fight 8@IIP80 too sensitive to criticism 8@IIP81 too responsible 8@IIP82 too irritated 8@IIP83 too easily persuaded8@IIP84 want too much admiration8@IIP85 too much like child 8@IIP86 too dependent 8@IIP87 too sensitive to rejection 8@IIP88 open up too much8@IIP89 too independent 8@IIP90 too aggressive 8@IIP91 try to please too much 8@IIP92 feel attacked 8@IIP93 too guilty 8@IIP94 clown around8@IIP95 wnat to be noticed 8@IIP96 criticize too much 8@IIP97 trust too much 8@IIP98 try to control 8@IIP99 avoid others8@IIP100 affected by others' moods 8@IIP101 other's needs first too much8@IIP102 try to change others8@IIP103 too gullible8@IIP104 overly generous 8@IIP105 too afraid of others8@IIP106 worry about others' reactions 8@IIP107 too suspicious 8@IIP108 too influenced by others8@IIP109 compliment others 8@IIP110 worry about disappointing 8@IIP111 manipulate others 8@IIP112 lose temper 8@IIP113 tell personal things8@IIP114 blame myself8@IIP115 too easily bothered 8@IIP116 argue too much 8@IIP117 too envious 8@IIP118 keep others at a distance 8@IIP119 worry about family's reactions 8@IIP120 let others take advantage 8@IIP121 lose sense of self 8@IIP122 feel too guilty 8@IIP123 feel competitive8@IIP124 feel embarrassed8@IIP125 too anxious 8@IIP126 affected by other's misery 8@IIP127 want revenge8@SCL1 headaches 8@SCL2 nervousness 8@SCL3 unpleasant thoughts 8@SCL4 faintness 8@SCL5 loss of sexual interest 8@SCL6 feeling critical of others 8@SCL7 someone can control thoughts8@SCL8 others are to blame for troubles8@SCL9 trouble mremembering things 8@SCL10 worried about sloppiness8@SCL11 easily annoyed 8@SCL12 pains in heart or chest 8@SCL13 afraid in open spaces 8@SCL14 low in energy 8@SCL15 thoughts of ending life 8@SCL16 hearing voices 8@SCL17 trembling 8@SCL18 not trust others8@SCL19 poor appetite 8@SCL20 crying easily 8@SCL21 feeling shy with opposite sex 8@SCL22 feeling trapped 8@SCL23 suddenly scared 8@SCL24 temper outbursts8@SCL25 afraid to go out of house 8@SCL26 blaming self8@SCL27 pains in lower back 8@SCL28 feeling blocked 8@SCL29 feeling lonely 8@SCL30 feeling blue8@SCL31 worrying too much 8@SCL32 feeling no interest 8@SCL33 feeling fearful 8@SCL34 feelings easily hurt8@SCL35 others aware of thoughts8@SCL36 others do not understand8@SCL37 others are unfriendly 8@SCL38 do thinngs slowly 8@SCL39 heart pounding 8@SCL40 nausea 8@SCL41 feeling inferior8@SCL42 soreness of muscles 8@SCL43 talked about by others 8@SCL44 trouble falling asleep 8@SCL45 having to double check 8@SCL46 difficulty making decisions 8@SCL47 afraid of buses, subway, train 8@SCL48 trouble getting breath 8@SCL49 hot or cold spells 8@SCL50 avoid things that frighten 8@SCL51 mind going blank8@SCL52 numbness or tingling8@SCL53 lump in throat 8@SCL54 feeling hopeless about future 8@SCL55 trouble concentrating 8@SCL56 feeling weak8@SCL57 feeling tense 8@SCL58 arms and legs heavy 8@SCL59 thoughts of death or dying 8@SCL60 overeating 8@SCL61 uneasy when others watch 8@SCL62 have thoughts that are not yours8@SCL63 urges to harm someone 8@SCL64 early wakening 8@SCL65 repeat actions 8@SCL66 restless sleep 8@SCL67 urges to break things 8@SCL68 ideas that others do not share 8@SCL69 feeling self-conscious 8@SCL70 uneasy in crowds8@SCL71 everything is an effort 8@SCL72 spells of panic 8@SCL73 not eat or drink in public 8@SCL74 get into arguments 8@SCL75 nervous when alone 8@SCL76 not get credit 8@SCL77 lonely with others 8@SCL78 so restless can't sit 8@SCL79 feelings of worthlessness 8@SCL80 s/t bad will happen 8@SCL81 shouting and throwing things8@SCL82 fear of fainting8@SCL83 people will take advantage 8@SCL84 bothersome thoughts of sex 8@SCL85 should be punished for sins 8@SCL86 thought that frighten 8@SCL87 something is wrong w/body 8@SCL88 never feel close to others' 8@SCL89 feelings of guilt 8@SCL90 something is wrong w/mind 8@SL1 language speak 8@SL2 language prefer 8@SL3 identify self 8@SL4 mom identify8@SL5 dad identify8@SL6 ethnicity of friends to age 6 8@SL7 ethnicity of friends to age 6-188@SL8 ethnicity of friends now8@SL9 preferred friends now 8@SL10 music preference8@SL11 movie preference8@SL12 generation 8@SL13 where raised8@SL14 contact with asia 8@SL15 food preference at home 8@SL16 food preference in restaurants 8@SL17 read8@SL18 write 8@SL19 asian pride 8@SL20 rate self 8@SL21 participate in asian occasions 8@SL22 believe in asian values 8@SL23 believe in american values 8@SL24 fit in with asians 8@SL25 fit in with americans 8@SL26 describe view of self 8@SCS1 unique 8@SCS2 talk8@SCS3 avoid argue 8@SCS4 rspct authority 8@SCS5 own thing 8@SCS6 modest 8@SCS7 independent 8@SCS8 sacrifice 8@SCS9 say no 8@SCS10 imagination 8@SCS11 parents adv 8@SCS12 fate8@SCS13 direct 8@SCS14 cooperate 8@SCS15 praise 8@SCS16 bro/sis 8@SCS17 rel w/oth 8@SCS18 speak up8@SCS19 bus seat8@SCS20 same anyone 8@SCS21 happiness 8@SCS22 health 8@SCS23 stay grp8@SCS24 for me 8@SCS25 care self 8@SCS26 grp decisions 8@SCS27 personal id 8@SCS28 grp harmony 8@SCS29 same sch/wk 8@SCS30 go along8@SCS31 first name 8@BELIEF1 should parents education8@BELIEF2 should parents date 8@BELIEF3 should parents emotional8@BELIEF4 should parents physical 8@BELIEF5 should same friend education8@BELIEF6 should same friend date 8@BELIEF7 should same friend physical 8@BELIEF8 should same friend emotion 8@BELIEF9 should other friend date8@BELIEF10should other friend education 8@BELIEF11should other friend physical8@BELIEF12(should other friend emotional well-being8@BELIEF13should anger one family 8@BELIEF14sholuld anger group family 8@BELIEF15should pride one family 8@BELIEF16should pride group family 8@BELIEF17should shame one family 8@BELIEF18should shame group family 8@BELIEF19should humility one family 8@BELIEF20should humility group family8@BELIEF21should anger one same friend8@BELIEF22should anger group same friends 8@BELIEF23should pride one same friend8@BELIEF24should pride group same friend 8@BELIEF25should shame one same friend8@BELIEF26should shame group same friends 8@BELIEF27should humility one same friend 8@BELIEF28"should humility group same friends 8@BELIEF29should anger one other friend 8@BELIEF30 should anger group other friends8@BELIEF31should pride one other friend 8@BELIEF32 should pride group other friends8@BELIEF33should shame one other friends 8@BELIEF34! should shame group other friends 8@BELIEF35!should humility one other friends 8@BELIEF36#should humility group other friends 8@BELIEF37should anger boss 8@BELIEF38should anger one coworker 8@BELIEF39should anger group coworkers8@BELIEF40should pride boss 8@BELIEF41should pride one coworker 8@BELIEF42should pride group coworkers8@BELIEF43should shame w/boss 8@BELIEF44should shame one coworker 8@BELIEF45should shame group coworkers8@BELIEF46should humility w/ boss 8@BELIEF47should humility w/one coworker 8@BELIEF48%should humility in group of coworkers 8@BELIEF49!should consider parents' opinions 8@BELIEF50should get help from parents8@BELIEF51family should agree 8@BELIEF52should spend time w/family 8@BELIEF53should contribute financially 8@BELIEF54"should financially support parents 8@BELIEF55should take parents into home 8@BELIEF56children should learn heritage 8@BELIEF57#children should support financially 8@BELIEF58children should take me in 8@BELIEF59"children should make own decisions 8@BELIEF60&should consider same friends' opinions 8@BELIEF61!should ask help from same friends 8@BELIEF62should agree with same friends 8@BELIEF63'should consider other friends' opinions 8@BELIEF64"should get help from other friends 8@BELIEF65should agree with other friends 8@BELIEF66"should participate in ethnic orgs. 8@BELIEF67"should consider coworkers opinions 8@BELIEF68%should handle problem w/out coworkers 8@BELIEF69coworkers should agree 8@BELIEF70ought to work alone 8@BELIEF71should return favor to peer 8@BELIEF72boss ought to praise privately 8@BELIEF73should tell boss disagree 8@BELIEF74should tell peers when disagree 8@BELIEF75should friendships w/coworkers 8@ACTL76 parents influence education 8@ACTL77 parents influence date 8@ACTL78 parents influence physical 8@ACTL79 parents influence emotional 8@ACTL80 same friend influence education 8@ACTL81 same friend influence date 8@ACTL82 same friend influence physical 8@ACTL83 same friend influence emotion 8@ACTL84 other friend influence education8@ACTL85 other friend influence date 8@ACTL86 other friend influence physical 8@ACTL87 2should other friend influence emotional well-being 8@ACTL88 show anger one family 8@ACTL89 show anger group family 8@ACTL90 show shame one family 8@ACTL91 show shame group family 8@ACTL92 show humility one family8@ACTL93 show humility group family 8@ACTL94 show pride one family 8@ACTL95 show pride group family 8@ACTL96 show anger one same friend 8@ACTL97 show anger group same friends 8@ACTL98 show shame one same friend 8@ACTL99 show shame group same friend8@ACTL100 show humility one same friend 8@ACTL101 !show humilitye group same friends 8@ACTL102 show pride one same friend 8@ACTL103 show pride group same friends 8@ACTL104 show anger one other friend 8@ACTL105 show anger group other friends 8@ACTL106 show pride one other friend 8@ACTL107 show pride group other friends 8@ACTL108 show shame one other friends8@ACTL109  show shame group other friends 8@ACTL110 show humility one other friends 8@ACTL111 !show humility group other friends 8@ACTL112 show anger boss 8@ACTL113 show anger one coworker 8@ACTL114 show anger group coworkers 8@ACTL115 show pride boss 8@ACTL116 show pride one coworker 8@ACTL117 show pride group coworkers 8@ACTL118 show shame w/boss 8@ACTL119 show shame one coworker 8@ACTL120 show shame group coworkers 8@ACTL121 show humility w/ boss 8@ACTL122 show humility w/one coworker8@ACTL123 #show humility in group of coworkers 8@ACTL124 consider parents' opinions 8@ACTL125 get help from parents 8@ACTL126 #oldest family member makes decision 8@ACTL127 spend time w/family 8@ACTL128 contribute financially to family8@ACTL129 financially support parents 8@ACTL130 take parents into home 8@ACTL131 teaching children heritage 8@ACTL132 !tell children support financially 8@ACTL133 tell children take me in8@ACTL134 tell children make own decisions8@ACTL135 consider same friends' opinions 8@ACTL136 ask help from same friends 8@ACTL137 agree with same friends 8@ACTL138 consider other friends' opinions8@ACTL139 get help from other friends 8@ACTL140 should agree with other friends 8@ACTL141 member in ethnic orgs. 8@ACTL142 consider coworkers opinions 8@ACTL143 handle problem w/out coworkers 8@ACTL144 coworkers agree 8@ACTL145 work alone 8@ACTL146 return favor to peer8@ACTL147 proud when boss praise in public8@ACTL148 tell coworker disagree 8@ACTL149 tell boss when disagree 8@ACTL150 have friendships w/coworkers8@SAT151 family ideal8@SAT152 family excellent8@SAT153 satisfied with family life 8@SAT154 satisfied important family 8@SAT155 not change family life 8@SAT156 social ideal8@SAT157 social conditions excellent 8@SAT158 satisfied social8@SAT159 satisifed important social 8@SAT160 not change social life 8@SAT161 work ideal 8@SAT162 work conditions excellent 8@SAT163 satisfied work life 8@SAT164 satisfied important work8@SAT165 not change work life8@SAT166 life ideal 8@SAT167 conditions life ideal 8@SAT168 satisfied with life 8@SAT169 satisfied important life8@SAT170 not change life 8@PARENT parental status 8@SLTOTAL Suinn-Lew Total 8@SLSCORE Suinn-Lew Score 8@FPROTECT fpbi-protectMCARE mpbi-care FINDEP fpbi-protect(discourage indep) MOVERPROmpbi-protect(overprotect) FOVERPROfpbi-protect(overprotect) FCARE fpbi-care MPBI7T MPROTECT mpbi-protectMINDEP mpbi-protect(discourage indep) ONLYKID only child SIB2T sib2 transformedDADTRAD Traditional Dad MOMTRAD Traditional Mom DADWEST Western Dad MOMWEST Western Mom YRSINUS years in US BDIDEP bdi-depressed CDIDEP cdi depressed OCCFT father's occ transformedOCCMOT mother's occ transformedSESCHILD childhood SES EDUCMF parent's education INCOMEMFchildhood income (occu. m & f) SCSINTERscsinterdepscore8@SCSINTAVscs interdependent average SCSINDEP scsindepscore SCSINDAVscs indpendent average SCSTYPE scs type8@PCARE parent pbicare 8@ONEHIC at least one hicare parent ONEHICM one hicare parent LANG54 LANG55 LANG56 LANG57 FBAVW family belief average w/out emo FAAVW family actual av w/out emo FAMAVDIWfamily average diff w/out emo FDIFWAB SBAVW social belief average w/out emo SAAVW social actual average w/out emo SOCAVDIW#social average difference w/out emo SAVDIWAB)absolute value of social av dif w/out emo WBAVW work belief average w/out emo WAAVW work actual average w/out emo WRKAVDIWwork average dif w/out emo WAVDIWAB&absolute value of wrk av dif w/out emo CCAPAVW IMIGRNT immigrant REFUGE refugee SETTLE settler SOJOURN sojourner SATTOT satisfaction total SATAV satisfaction averageSATFAM family satisfaction SATSOC social satisfaction SATWRK work satisfaction SATLIFE life satisfaction SOCSTGY social strategy 8@FAMSTGY family strategy 8@WRKSTGY work strategy 8@DLYSTGY daily strategy 8@IDSTGY identifcation strategy 8@YRSUS grouped years in us 19978@SIB1GIRLsibling 1 girl 8@SIB1BOY sibling 1 boy 8@SIB2GIRLsibling 2 girl 8@SIB2BOY sibling 2 boy 8@SIB3GIRLsibling 3 girl 8@SIB3BOY sibling 3 boy 8@SIB4GIRLsibling 4 girl 8@SIB4BOY sibling 4 boy 8@SIB5GIRLsibling 5 girl 8@SIB5BOY sibling 5 boy 8@SIBBOYTLsibling boy total 8@SIBGRLTLsibling girl total 8@SIBTOTALchildren in fam of origin COLLEGEMMom went to college COLLEGEFDad went to college COLLEGEPParents went to college MOMWORKDMom worked/studied MOMOCCU Mom's occupation category DADOCCU Dad's occupation category WANTBOY want sonWANTGIRL want daughter BDICDI level of sadness/depression MFTRAD Mom & dad traditional 8@BOTHTRADboth parents traditional8@MFMATCH mf match on trad status 8@MFTRADV2Mom & dad traditional v.2 8@INFLUET influence transformed 8@SCSHIIND scs hi indep8@SCSHIINTscs hi interdependence 8@INRELATNin a relationship PREFENGLprefer English 8@DALY60ATdaily60a transformedDALY62ATdaily 62a transformed DALY64ATdaily 64a transformed MFCGRAD both parents college grads 8@FAVDIFABSIBS CNTRYS FAAVWT BDIDEP2 SCLSOMT SCLSOMAVSOMTSCR scl somatization t-scoreSOMPOS sompos 8@SOMCAS somcas SCLPSYT SCLPSYAVPSYTSCR scl psychotocism t-scorePSYPOS PSYCAS psycas SCLPART SCLPARAVPARTSCR scl paranoia t-scorePARCAS SCLPHOT SCLPHOAVPHOTSCR scl phobia t-score PHOPOS PHOBCAS phobcas SCLHOST SCLHOSAVHOSTSCR scl hostility t-score HOSPOS HOSCAS hoscas SCLIST SCLISAV ISTSCR scl int. sensitivity t-scoreISPOS ispos 8@ISCAS iscas SCLDEPT SCLDEPAVDEPTSCR scl depression t-score DEPPOS deppos 8@DEPCAS depcas SCLANXT SCLANXAVANXTSCR scl anxiety t-score ANXPOS anxpos 8@ANXCAS anxcas SCLOCT SCLOCAV OCTSCR scl oc t score OCPOS ocpos OCCAS occas SCLADDT SCLADDAVSCLGSI SCLGSIAVGSI global severity index GSITSCR scl gsi t score GSIPOS gsipos GSICAS SCLTOT SCLCAST sclcastotal SCLCASE2sclcase2SCLPST PSTSCR scl pst t score SCLPSDI PSDITSCR PSDI T scoreSCLVLD PSDPOS PSTPOS FAM1 belief1-actl76 8@FAM2 belief2t-actl77 8@FAM3 belief1-actl76 8@FAM4 belief1-actl76 8@FAM5 belief1-actl76 8@FAM13 belief1-actl76 8@FAM14 belief1-actl76 8@FAM15 belief1-actl76 8@FAM16 belief1-actl76 8@FAM17 belief1-actl76 8@FAM18 FAM19 FAM20 FAM49 FAM50 FAM51 FAM52 FAM53 FAM54 FAM55 FAM56 FAM57 FAM58 FAM59 SDIFWAB WDIFWAB TDIFWAB DAILY38 DAILY43 WK37DIF WK38DIF WK39DIF WK40DIF WK41DIF WK42DIF WK43DIF WK44DIF WK45DIF WK46DIF WK47DIF WK48DIF WK67DIF WK68DIF WK69DIF WK70DIF WK71DIF WK72DIF WK73DIF WK74DIF WK75DIF SOC5 SOC6 SOC7 SOC8 SOC9 SOC10 SOC11 SOC12 SOC21 SOC22 SOC23 SOC24 SOC25 SOC26 SOC27 SOC28 SOC29 SOC30 8@SOC31 SOC32 SOC33 SOC34 SOC35 SOC36 SOC60 SOC61 SOC62 SOC63 SOC64 SOC65 SOC66 FAIN family actual ind/int 8@FBIN family belief ind/int 8@SAIN 8@SBIN 8@WAIN 8@WBIN 8@DIN 8@FDOMAVW FCBAV FCAAV FCAVDIF SDOMAVW SSAME SOTHER WDOMAVW WKDIF WKDIFNP WKDIFNN WKDIFTN WKDIFAV FMDIF FMDIFNP FMDIFNN FMDIFTN FMDIFAV SCDIF CCAPDIF SCDIFNP SCDIFNN SCDIFTN SCDIFAV CCAPTN CCAPDFAVCCAPDNP CCAPDNN WK67POS WK68POS WK69POS WK70POS WK71POS WK73POS WK74POS WK75POS WK67NEG WK68NEG WK69NEG WK70NEG WK71NEG WK73NEG WK74NEG WK75NEG WKDIFMP work pos dif magnitude WKDIFMN work neg dif magnitude FAM1POS FAM2POS FAM3POS FAM4POS FAM49POSFAM50POSFAM51POSFAM52POSFAM53POSFAM54POSFAM55POSFAM1NEG FAM2NEG FAM3NEG FAM4NEG FAM49NEGFAM50NEGFAM51NEGFAM52NEGFAM53NEGFAM54NEGFAM55NEGFMDIFMP fam pos dif magnitude FMDIFMN fam neg dif magnitude SOC5POS SOC6POS SOC7POS SOC8POS SOC60POSSOC61POSSOC62POSSOC63POSSOC64POSSOC65POSSOC66POSSOC5NEG SOC6NEG SOC7NEG SOC8NEG SOC60NEGSOC61NEGSOC62NEGSOC63NEGSOC64NEGSOC65NEGSOC66NEGSCDIFMP soc pos dif magnitude SCDIFMN soc neg dif magnitude FSBDIF FWBDIF SWBDIF FSADIF FWADIF SWADIF WKDIFMT total work dif magnitude FMDIFMT total fam dif magnitude SCDIFMT total soc dif magnitude CCAPDFMTtotal ccap dif magnitudeANOVA anova groupsCCAPDFMPtotal positiv dif for ccap CCAPDFMNtotal negative dif for ccap BKS TV MOVIE RADIO REST EAT NEWS DLYAV1 DLYAV ccap daily domain average WKDIFMAVFMDIFMAVSCDIFMAVCCAPDFTNCCAPDFMVWKDIF2NPWKDIF2NNWKDIF2TNFMDIF2NPFMDIF2NNFMDIF2TNSCDIF2NPSCDIF2NNSCDIF2TNUSYRS POSSOM POSOC POSIS POSDEP POSANX POSHOS POSPHOB POSPAR POSPSY POSGSI POSPST POSPSDI WESTERN IMTOT MISSIIP ANGRBTOTANGRBAVEanger belief mean ANGRATOTANGRAAVEANGRTOT ANGRTAVEtotal mean for angerANGRFTOTANGRFAVEANGRPUBTANGRPUBAANGRFPDFPRIDBTOTPRIDBAVEPRIDATOTPRIDAAVEPRIDTOT PRIDAVE SHAMBT SHAMBAVESHAMAT SHAMAAVESHAMT SHAMAVE HUMBT HUMBAVE HUMAT HUMAAVE EMOTACT EMOTAAVEACCULTLVSAT151T SAT152T SAT153T SAT154T SAT155T SAT156T SAT157T SAT158T SAT159T SAT160T SAT161T SAT162T SAT163T SAT164T SAT165T SAT166T SAT167T SAT168T SAT169T SAT170T FAMSAT SOCSAT FAMSAVE SOCSAVE WORKSAT WORKSAV GENSAT GENAVE INCOMCATMARCAT HILOIDAV High IND, (4) HILOITAV High INT, (4) BERRY Berry's Acculturation Types, (4)WHILOID High IND, (Mean = 4.85) WHILOIT High INT, (Mean = 4.85) INDINTDFPARSTY PC$BELIE'Parent Child should financially support PC$BEHAV#Parent child do financially support PCLIVBELparent child should take in PCLIVBEHparent child take inBBFINANC)beliefs and behaviors financially support BBTAKEIN%beliefs and behaviors take in parents BBCONFLT)discrepancy between beliefs and behaviors PCCONFLT1parent child discrepancy in beliefs and behaviors FAMILYSAsatisfaction with family life 8@  RESID$ $ standardized residual for financial  RESIDHOM(Standardized Residual for take into home  BELHOME 7Standardized Residual for belief should take parents in   BEL$ *Standardized Residual for belief financial   BEH$ ,Standardized Residual for behavior financial  BEHHOME 9Standardized Residual for behavior take parents into home BERRZ +Berry's Modified Acculturation Types (4.85) SCSDFCATDifference btwn IND, INTBILINGU BILINGS BILTRUE CDISUIC !Sum of suicide items from the CDI WESTSUIC)Sum of suicide items from BDI and SCL-90R TOTSUIC +Sum of all suicide items (CDI, BDI, SCL-90) SLASIAGRhigh and low scores on SLAsia CBAPTOTLCBBAP total score CBELTOTLCBBAP belief total scoreCBELAV CBBAP belief average score CBEHTOTLCBBAP behavior total score CBEHAV CBBAP behavior average scoreCBBPWRKTCBBAP work totalCBBPWRKACBBAP work average CBPWRKBLCBBAP work belief average CBPWRKBHCBBAP work behavior average CBBPSCLTCBBAP social total CBBPSCLACBBAP social averageCBPSCLBLCBBAP social belief average CBPSCLBHCBBAP social behavior average CBBPFAMTCBBAP family total CBBPFAMACBBAP family averageCBPFAMBLCBBAP family beliefs averageCBPFAMBHCBBAP family behavior average DCP2_26 %Discrepancy between CBBAP items 2, 26 DCP3_27 Discrepancy between CBBAP items DCP4_28 Discrepancy between CBBAP items DCP5_29 Discrepancy between CBBAP items DCP6_30 Discrepancy between CBBAP items DCP7_31 Discrepancy between CBBAP items DCP8_33 Discrepancy between CBBAP items DCP9_35 Discrepancy between CBBAP items DCP10_36Discrepancy between CBBAP items DCP11_38Discrepancy between CBBAP items DCP14_41Discrepancy between CBBAP items DCP15_43Discrepancy between CBBAP items DCP16_44Discrepancy between CBBAP items DCP17_45Discrepancy between CBBAP items DCP18_47Discrepancy between CBBAP items DCP19_48Discrepancy between CBBAP items DCP20_50Discrepancy between CBBAP items DCP21_49Discrepancy between CBBAP items LDC2_26 (Larger Discrepancies between CBBAP itemsLDC3_27 (Larger Discrepancies between CBBAP itemsLDC4_28 (Larger Discrepancies between CBBAP itemsLDC5_29 (Larger Discrepancies between CBBAP itemsLDC6_30 (Larger Discrepancies between CBBAP itemsLDC7_31 (Larger Discrepancies between CBBAP itemsLDC8_33 (Larger Discrepancies between CBBAP itemsLDC9_35 (Larger Discrepancies between CBBAP itemsLDC10_36(Larger Discrepancies between CBBAP itemsLDC11_38(Larger Discrepancies between CBBAP itemsLDC14_41(Larger Discrepancies between CBBAP itemsLDC15_43(Larger Discrepancies between CBBAP itemsLDC16_44(Larger Discrepancies between CBBAP itemsLDC17_45(Larger Discrepancies between CBBAP itemsLDC18_47(Larger Discrepancies between CBBAP itemsLDC19_48(Larger Discrepancies between CBBAP itemsLDC20_50(Larger Discrepancies between CBBAP itemsLDC21_49(Larger Discrepancies between CBBAP itemsPDC2_26 )Positve Discrepancies between CBBAP items PDC3_27 *Positive Discrepancies between CBBAP items PDC4_28 *Positive Discrepancies between CBBAP items PDC5_29 *Positive Discrepancies between CBBAP items PDC6_30 *Positive Discrepancies between CBBAP items PDC7_31 *Positive Discrepancies between CBBAP items PDC8_33 *Positive Discrepancies between CBBAP items PDC9_35 *Positive Discrepancies between CBBAP items PDC10_36*Positive Discrepancies between CBBAP items PDC11_38*Positive Discrepancies between CBBAP items PDC14_41*Positive Discrepancies between CBBAP items PDC15_43*Positive Discrepancies between CBBAP items PDC16_44*Positive Discrepancies between CBBAP items PDC17_45*Positive Discrepancies between CBBAP items PDC18_47*Positive Discrepancies between CBBAP items PDC19_48*Positive Discrepancies between CBBAP items PDC20_50*Positive Discrepancies between CBBAP items PDC21_49*Positive Discrepancies between CBBAP items MPBICAREPBI Mother's Care total score FPBICAREPBI Father's Care total score MPBIO_P 'PBI Mother's Overprotection total score FPBIO_P 'PBI Father's Overprotection total score MCAREGRPPBI Mother's Care groupsFCAREGRPPBI Father's care groups MO_PGRP "PBI Mother's Overprotection groups FO_PGRP "PBI Father's Overprotection groups MPBIGRP PBI Mother's Quadrants FPBIGRP PBI Father's Quadrants CAREGRP PBI care - both parents O_PGRP !PBI Overprotection - both parents PBIOPTGRPBI - which bonds are optimal? PBIACGR +PBI - which bonds are affectionless control ?checkedno ?yes B/cdefghtuvwx ,-./0123459:<CDIJNWX]fkoptuyz~?asian @ caucasian  not at all ? occasionally @ sometimes @ quite often @always  ?18-29 @30-39 @40-49 @50-59 @60-69 @70-79 @80-89 Jmale ?female Knopqr?born in the US @ 0-10 years @ 11-20 years @ 21-30 years @31-40 @41-50 @51-60 @ > 61 years N?first generation @second generation @third generation @fourth generation @> fourth generation O?mother @ grandmother @aunt V?professional/technical @mgt/clerical/sales/bus owner @ skilled labor @semiskilled labor @unskilled labor@not in labor force @studentW]?some elementary@ middle school @ high school @ trade school @college@graduate schoolX^~?father @ grandfather @uncle \?father @mother @ both parents @ grandmother @ grandfather @another relative @another non-relative i?strongly agree @agree @somewhat agree @somewhat disagree @disagree @strongly disagree jklm? never married @married@living with partner @divorced @engaged@ separated @widowed @other y?<15k @<25k @<35k @<50k @<65k @<100k @>100k no ?yes @ sometimes ? Christian @Buddhist @Jewish @non-Christian type church @Wiccan ? same culture @many different cultures@specific different culture @other ? had no choice @ wanted to ?visitor/student/temp worker @ to settle No ?Yes ? same income @ less income @ more income ? same culture @different cultures @specific different culture @other ?strongly agree @agree @somewhat agree @somewhat disagree @disagree @strongly disagree @not applicable ?English?daily @1xweekly @ 1xmonthly @1xyearly @ <1xyearly @never ? available @ inconvenient @ notavailable ?most important @middle @less important  very like ?moderately like@moderately unlike @ very unlike 2      !"#$%&'()*+, not at all ? a little bit @ moderately @ quite a bit @ extremely -./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefijklmnopqrstuvwxyz{|}~? asian only @mostly asian, some english @ bilingual @mostly asian, some english @ only english ?oriental @asian @asian-american @chinese-american @american   ?exclusively asian @ mostly asian @equally asian and anglo@mostly non-asians @exclusively non-asians    ? only asian @ mostly asian @equally english and asian @mostly english @ only english ?first generation @second generation @ third gen. @ fourth gen @ fifth gen @lack information ? asia only @mostly asia, some us @equally asia and us @mostly us, some asia @ in us only ?raised > one year @ lived <1 yr @occasional visits @occasional communication @ no exposure ?exclusively asian @ mostly asian @equally asian and american @mostly american@exclusively american ?only asian language @ asian better @#both asian and english equally well @english better @ only english ?extremely proud@moderately proud @ little pride @no pride, no negative @no pride, negative feelings ? very asian @ mostly asian @ bicultural @mostly westernized @very westernized ? nearly all @most @some @a few @none ?do not believe @2 @3 @4 @strongly believe ? do not fit @2 @3 @4 @ fit very well ?asian @ american @asian-american @american-asian @ bicultural ?strongly disagree @disagree @somewhat disagree @disagree @agree somewhat @agree @strongly agree  !"#$%&'()*+,-./0123456789:;<=>?strongly agree @agree @somewhat agree @somewhat disagree @ disagree @strongly disagree @strongly agree ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ nonparent ?parent  has siblings ? only child  no strategy ?hi indep/lo inter @ bicultural @hi inter/lo indep  both low care ?fhicare and mlowcare @mhicare and flowcare @ both hicare father ?mother  US born? Immigrant ? integration @ assimilation @ separation @marginalization&'()*?0-1 @2-5 @6-10 @11-15 @16-45 @ born in us +neither parent went ? only Mom went @ only Dad went @both parents went ; homemaker ?unskilled-skilled labor@mgr-professional =not in labor force ?unskilled-skilled @mgr-professional > don't know ?maybe ?@not sad/depressed ?history of sadness @clinically depressed Aneither parent trad ?one parent trad@both parents trad Bneither parent trad ? only mom trad @ only dad trad @both parents trad E?father @mother @ both parents @other Flow IND?high IND Glow INT?high INT H"@English not endorsed KLM? independent @interdependent ?first generation chinese @> 1st gen chinese @ caucasian R? assimilation @ seperation @ integration @marginalization? Higher IND @ Higher INT @ IND = INT  below mean ? Above mean "#$%?Optimal Bonding@Affectionate Constraint@ Weak bonding @Affectionless Control &'? Both high @ Only Mom High @ Only Dad High @Neither parent high ()?Optimal bond with both parents @Optimal bond with mom @Optimal bond with dad @ Optimal bond with neither parent *?$neither parent affectionless control @mom affectionless control @dad affectionless control @"both parents affectionless control +    6LID=id MISS=miss SAMP130=samp130 CHECK=check INTRWCON=intrwcon RACE=race CDI1=cdi1 CDI2=cdi2 CDI3=cdi3 CDI4=cdi4 CDI5=cdi5 CDI6=cdi6 CDI7=cdi7 CDI8=cdi8 CDI9=cdi9 CDI10=cdi10 CDI11=cdi11 CDI12=cdi12 CDI13=cdi13 CDI14=cdi14 CDI15=cdi15 CDI16=cdi16 CDI17=cdi17 CDI18=cdi18 CDI19=cdi19 CDI20=cdi20 CDITOTAL=cditotal BDI1=bdi1 BDI2=bdi2 BDI3=bdi3 BDI4=bdi4 BDI5=bdi5 BDI6=bdi6 BDI7=bdi7 BDI8=bdi8 BDI9=bdi9 BDI10=bdi10 BDI11=bdi11 BDI12=bdi12 BDI13=bdi13 BDI14=bdi14 BDI15=bdi15 BDI16=bdi16 BDI17=bdi17 BDI18=bdi18 BDI19=bdi19 BDI19A=bdi19a BDI20=bdi20 BDI21=bdi21 BDITOTAL=bditotal BDI2TOTA=bdi2total BDI2_01=bdi2_01 BDI2_02=bdi2_02 BDI2_03=bdi2_03 BDI2_04=bdi2_04 BDI2_05=bdi2_05 BDI2_06=bdi2_06 BDI2_07=bdi2_07 BDI2_08=bdi2_08 BDI2_09=bdi2_09 BDI2_10=bdi2_10 BDI2_11=bdi2_11 BDI2_12=bdi2_12 BDI2_13=bdi2_13 BDI2_14=bdi2_14 BDI2_15=bdi2_15 BDI2_16=bdi2_16 BDI2_17=bdi2_17 BDI2_18=bdi2_18 BDI2_19=bdi2_19 BDI2_20=bdi2_20 BDI2_21=bdi2_21 AGE=age AGERANGE=agerange GENDER=gender COUNTRY=country IMMIYEAR=immiyear USLENGTH=uslength GENERATN=generatn ETHNIC1=ethnic1 ETHNIC2=ethnic2 ETHNIC3=ethnic3 ETHNICM1=ethnicm1 ETHNICM2=ethnicm2 ETHNICM3=ethnicm3 RELM=relm OCCMO=occmo EDUCM=educm ETHNICF1=ethnicf1 ETHNICF2=ethnicf2 ETHNICF3=ethnicf3 RELF=relf OCCF=occf EDUCF=educf ETHDAD1=ethdad1 ETHDAD2=ethdad2 ETHMOM1=ethmom1 ETHMOM2=ethmom2 MARITAL1=marital1 MARITAL2=marital2 MARITAL3=marital3 MARITAL4=marital4 MARITAL5=marital5 MARITAL6=marital6 INFLUEN=influen TRADMOM=tradmom WESTMOM=westmom TRADDAD=traddad WESTDAD=westdad SIB1=sib1 SIB2=sib2 SIB3=sib3 SIB4=sib4 SIB5=sib5 BIRTHORD=birthord RESALONE=resalone RESPAR=respar RESSIG=ressig RESROOM=resroom RESOTHER=resother MARITAL=marital ETHPART1=ethpart1 ETHPART2=ethpart2 ETHPART3=ethpart3 CHILDREN=children EDUC=educ COUNTRY1=country1 CNTRY1YR=cntry1yr COUNTRY2=country2 CNTRY2YR=cntry2yr COUNTRY3=country3 CNTRY3YR=cntry3yr COUNTRY4=country4 CNTRY4YR=cntry4yr LSCHOOL=lschool LSCHYRS=lschyrs INCOME=income OCCSELF=occself RELPRAC=relprac TYPEREL=typerel NEIGHBOR=neighbor IMMCAUSE=immcause IMMTYPE=immtype SPONREL=sponrel SPONFRD=sponfrd SPONSCH=sponsch SPONSPA=sponspa SPONSOTH=sponsoth INCOMEUS=incomeus FRIENDS=friends DEPHX=dephx MHHELP=mhhelp MHTYPE1=mhtype1 MHTYPE2=mhtype2 MHTYPE3=mhtype3 MHTYPE4=mhtype4 MHTYPE5=mhtype5 MHTYPE6=mhtype6 PSYHOSP=psyhosp DISCRM48=discrm48 DISCRM49=discrm49 DAILY50A=daily50a DAILY50B=daily50b DAILY50C=daily50c DAILY50D=daily50d DAILY51A=daily51a DAILY51B=daily51b DAILY51C=daily51c DAILY51D=daily51d DAILY52A=daily52a DAILY52B=daily52b DAILY52C=daily52c DAILY52D=daily52d DAILY53A=daily53a DAILY53B=daily53b DAILY53C=daily53c DAILY53D=daily53d DAILY54A=daily54a DAILY54B=daily54b DAILY54C=daily54c DAILY54D=daily54d DAILY55A=daily55a DAILY55B=daily55b DAILY55C=daily55c DAILY55D=daily55d DAILY56A=daily56a DAILY56B=daily56b DAILY56C=daily56c DAILY56D=daily56d DAILY57A=daily57a DAILY57B=daily57b DAILY57C=daily57c DAILY57D=daily57d DAILY58A=daily58a DAILY58B=daily58b DAILY58C=daily58c DAILY58D=daily58d DAILY59A=daily59a DAILY59B=daily59b DAILY59C=daily59c DAILY59D=daily59d DAILY60A=daily60a DAILY60B=daily60b DAILY60C=daily60c DAILY60D=daily60d DAILY61A=daily61a DAILY61B=daily61b DAILY61C=daily61c DAILY61D=daily61d DAILY62A=daily62a DAILY62B=daily62b DAILY62C=daily62c DAILY62D=daily62d DAILY63A=daily63a DAILY63B=daily63b DAILY63C=daily63c DAILY63D=daily63d DAILY64A=daily64a DAILY64B=daily64b DAILY64C=daily64c DAILY64D=daily64d ETHNICIT=ethnicit BKSAVAIL=bksavail BKSUSE=bksuse NEWSAVL=newsavl NEWSUSE=newsuse TVAVAIL=tvavail TVUSE=tvuse MOVIEAVL=movieavl MOVIEUSE=movieuse RADIOAVL=radioavl RADIOUSE=radiouse RESTRAVL=restravl RESTRUSE=restruse STOREAVL=storeavl ETHNEAT=ethneat FAMRANK=famrank SOCRANK=socrank WORKRANK=workrank MYETHNIC=myethnic SOCIALA=sociala SOCIALW=socialw WORKA=worka WORKW=workw DAILYA=dailya DAILYW=dailyw FAMILYA=familya FAMILYW=familyw IDENTA=identa IDENTW=identw MPBI1=mpbi1 MPBI2=mpbi2 MPBI3=mpbi3 MPBI4=mpbi4 MPBI5=mpbi5 MPBI6=mpbi6 MPBI7=mpbi7 MPBI8=mpbi8 MPBI9=mpbi9 MPBI10=mpbi10 MPBI11=mpbi11 MPBI12=mpbi12 MPBI13=mpbi13 MPBI14=mpbi14 MPBI15=mpbi15 MPBI16=mpbi16 MPBI17=mpbi17 MPBI18=mpbi18 MPBI19=mpbi19 MPBI20=mpbi20 MPBI21=mpbi21 MPBI22=mpbi22 MPBI23=mpbi23 MPBI24=mpbi24 MPBI25=mpbi25 FPBI1=fpbi1 FPBI2=fpbi2 FPBI3=fpbi3 FPBI4=fpbi4 FPBI5=fpbi5 FPBI6=fpbi6 FPBI7=fpbi7 FPBI8=fpbi8 FPBI9=fpbi9 FPBI10=fpbi10 FPBI11=fpbi11 FPBI12=fpbi12 FPBI13=fpbi13 FPBI14=fpbi14 FPBI15=fpbi15 FPBI16=fpbi16 FPBI17=fpbi17 FPBI18=fpbi18 FPBI19=fpbi19 FPBI20=fpbi20 FPBI21=fpbi21 FPBI22=fpbi22 FPBI23=fpbi23 FPBI24=fpbi24 FPBI25=fpbi25 IIP1=iip1 IIP2=iip2 IIP3=iip3 IIP4=iip4 IIP5=iip5 IIP6=iip6 IIP7=iip7 IIP8=iip8 IIP9=iip9 IIP10=iip10 IIP11=iip11 IIP12=iip12 IIP13=iip13 IIP14=iip14 IIP15=iip15 IIP16=iip16 IIP17=iip17 IIP18=iip18 IIP19=iip19 IIP20=iip20 IIP21=iip21 IIP22=iip22 IIP23=iip23 IIP24=iip24 IIP25=iip25 IIP26=iip26 IIP27=iip27 IIP28=iip28 IIP29=iip29 IIP30=iip30 IIP31=iip31 IIP32=iip32 IIP33=iip33 IIP34=iip34 IIP35=iip35 IIP36=iip36 IIP37=iip37 IIP38=iip38 IIP39=iip39 IIP40=iip40 IIP41=iip41 IIP42=iip42 IIP43=iip43 IIP44=iip44 IIP45=iip45 IIP46=iip46 IIP47=iip47 IIP48=iip48 IIP49=iip49 IIP50=iip50 IIP51=iip51 IIP52=iip52 IIP53=iip53 IIP54=iip54 IIP55=iip55 IIP56=iip56 IIP57=iip57 IIP58=iip58 IIP59=iip59 IIP60=iip60 IIP61=iip61 IIP62=iip62 IIP63=iip63 IIP64=iip64 IIP65=iip65 IIP66=iip66 IIP67=iip67 IIP68=iip68 IIP69=iip69 IIP70=iip70 IIP71=iip71 IIP72=iip72 IIP73=iip73 IIP74=iip74 IIP75=iip75 IIP76=iip76 IIP77=iip77 IIP78=iip78 IIP79=iip79 IIP80=iip80 IIP81=iip81 IIP82=iip82 IIP83=iip83 IIP84=iip84 IIP85=iip85 IIP86=iip86 IIP87=iip87 IIP88=iip88 IIP89=iip89 IIP90=iip90 IIP91=iip91 IIP92=iip92 IIP93=iip93 IIP94=iip94 IIP95=iip95 IIP96=iip96 IIP97=iip97 IIP98=iip98 IIP99=iip99 IIP100=iip100 IIP101=iip101 IIP102=iip102 IIP103=iip103 IIP104=iip104 IIP105=iip105 IIP106=iip106 IIP107=iip107 IIP108=iip108 IIP109=iip109 IIP110=iip110 IIP111=iip111 IIP112=iip112 IIP113=iip113 IIP114=iip114 IIP115=iip115 IIP116=iip116 IIP117=iip117 IIP118=iip118 IIP119=iip119 IIP120=iip120 IIP121=iip121 IIP122=iip122 IIP123=iip123 IIP124=iip124 IIP125=iip125 IIP126=iip126 IIP127=iip127 SCL1=scl1 SCL2=scl2 SCL3=scl3 SCL4=scl4 SCL5=scl5 SCL6=scl6 SCL7=scl7 SCL8=scl8 SCL9=scl9 SCL10=scl10 SCL11=scl11 SCL12=scl12 SCL13=scl13 SCL14=scl14 SCL15=scl15 SCL16=scl16 SCL17=scl17 SCL18=scl18 SCL19=scl19 SCL20=scl20 SCL21=scl21 SCL22=scl22 SCL23=scl23 SCL24=scl24 SCL25=scl25 SCL26=scl26 SCL27=scl27 SCL28=scl28 SCL29=scl29 SCL30=scl30 SCL31=scl31 SCL32=scl32 SCL33=scl33 SCL34=scl34 SCL35=scl35 SCL36=scl36 SCL37=scl37 SCL38=scl38 SCL39=scl39 SCL40=scl40 SCL41=scl41 SCL42=scl42 SCL43=scl43 SCL44=scl44 SCL45=scl45 SCL46=scl46 SCL47=scl47 SCL48=scl48 SCL49=scl49 SCL50=scl50 SCL51=scl51 SCL52=scl52 SCL53=scl53 SCL54=scl54 SCL55=scl55 SCL56=scl56 SCL57=scl57 SCL58=scl58 SCL59=scl59 SCL60=scl60 SCL61=scl61 SCL62=scl62 SCL63=scl63 SCL64=scl64 SCL65=scl65 SCL66=scl66 SCL67=scl67 SCL68=scl68 SCL69=scl69 SCL70=scl70 SCL71=scl71 SCL72=scl72 SCL73=scl73 SCL74=scl74 SCL75=scl75 SCL76=scl76 SCL77=scl77 SCL78=scl78 SCL79=scl79 SCL80=scl80 SCL81=scl81 SCL82=scl82 SCL83=scl83 SCL84=scl84 SCL85=scl85 SCL86=scl86 SCL87=scl87 SCL88=scl88 SCL89=scl89 SCL90=scl90 SL1=sl1 SL2=sl2 SL3=sl3 SL4=sl4 SL5=sl5 SL6=sl6 SL7=sl7 SL8=sl8 SL9=sl9 SL10=sl10 SL11=sl11 SL12=sl12 SL13=sl13 SL14=sl14 SL15=sl15 SL16=sl16 SL17=sl17 SL18=sl18 SL19=sl19 SL20=sl20 SL21=sl21 SL22=sl22 SL23=sl23 SL24=sl24 SL25=sl25 SL26=sl26 SCS1=scs1 SCS2=scs2 SCS3=scs3 SCS4=scs4 SCS5=scs5 SCS6=scs6 SCS7=scs7 SCS8=scs8 SCS9=scs9 SCS10=scs10 SCS11=scs11 SCS12=scs12 SCS13=scs13 SCS14=scs14 SCS15=scs15 SCS16=scs16 SCS17=scs17 SCS18=scs18 SCS19=scs19 SCS20=scs20 SCS21=scs21 SCS22=scs22 SCS23=scs23 SCS24=scs24 SCS25=scs25 SCS26=scs26 SCS27=scs27 SCS28=scs28 SCS29=scs29 SCS30=scs30 SCS31=scs31 BELIEF1=belief1 BELIEF2=belief2 BELIEF3=belief3 BELIEF4=belief4 BELIEF5=belief5 BELIEF6=belief6 BELIEF7=belief7 BELIEF8=belief8 BELIEF9=belief9 BELIEF10=belief10 BELIEF11=belief11 BELIEF12=belief12 BELIEF13=belief13 BELIEF14=belief14 BELIEF15=belief15 BELIEF16=belief16 BELIEF17=belief17 BELIEF18=belief18 BELIEF19=belief19 BELIEF20=belief20 BELIEF21=belief21 BELIEF22=belief22 BELIEF23=belief23 BELIEF24=belief24 BELIEF25=belief25 BELIEF26=belief26 BELIEF27=belief27 BELIEF28=belief28 BELIEF29=belief29 BELIEF30=belief30 BELIEF31=belief31 BELIEF32=belief32 BELIEF33=belief33 BELIEF34=belief34 BELIEF35=belief35 BELIEF36=belief36 BELIEF37=belief37 BELIEF38=belief38 BELIEF39=belief39 BELIEF40=belief40 BELIEF41=belief41 BELIEF42=belief42 BELIEF43=belief43 BELIEF44=belief44 BELIEF45=belief45 BELIEF46=belief46 BELIEF47=belief47 BELIEF48=belief48 BELIEF49=belief49 BELIEF50=belief50 BELIEF51=belief51 BELIEF52=belief52 BELIEF53=belief53 BELIEF54=belief54 BELIEF55=belief55 BELIEF56=belief56 BELIEF57=belief57 BELIEF58=belief58 BELIEF59=belief59 BELIEF60=belief60 BELIEF61=belief61 BELIEF62=belief62 BELIEF63=belief63 BELIEF64=belief64 BELIEF65=belief65 BELIEF66=belief66 BELIEF67=belief67 BELIEF68=belief68 BELIEF69=belief69 BELIEF70=belief70 BELIEF71=belief71 BELIEF72=belief72 BELIEF73=belief73 BELIEF74=belief74 BELIEF75=belief75 ACTL76=actl76 ACTL77=actl77 ACTL78=actl78 ACTL79=actl79 ACTL80=actl80 ACTL81=actl81 ACTL82=actl82 ACTL83=actl83 ACTL84=actl84 ACTL85=actl85 ACTL86=actl86 ACTL87=actl87 ACTL88=actl88 ACTL89=actl89 ACTL90=actl90 ACTL91=actl91 ACTL92=actl92 ACTL93=actl93 ACTL94=actl94 ACTL95=actl95 ACTL96=actl96 ACTL97=actl97 ACTL98=actl98 ACTL99=actl99 ACTL100=actl100 ACTL101=actl101 ACTL102=actl102 ACTL103=actl103 ACTL104=actl104 ACTL105=actl105 ACTL106=actl106 ACTL107=actl107 ACTL108=actl108 ACTL109=actl109 ACTL110=actl110 ACTL111=actl111 ACTL112=actl112 ACTL113=actl113 ACTL114=actl114 ACTL115=actl115 ACTL116=actl116 ACTL117=actl117 ACTL118=actl118 ACTL119=actl119 ACTL120=actl120 ACTL121=actl121 ACTL122=actl122 ACTL123=actl123 ACTL124=actl124 ACTL125=actl125 ACTL126=actl126 ACTL127=actl127 ACTL128=actl128 ACTL129=actl129 ACTL130=actl130 ACTL131=actl131 ACTL132=actl132 ACTL133=actl133 ACTL134=actl134 ACTL135=actl135 ACTL136=actl136 ACTL137=actl137 ACTL138=actl138 ACTL139=actl139 ACTL140=actl140 ACTL141=actl141 ACTL142=actl142 ACTL143=actl143 ACTL144=actl144 ACTL145=actl145 ACTL146=actl146 ACTL147=actl147 ACTL148=actl148 ACTL149=actl149 ACTL150=actl150 SAT151=sat151 SAT152=sat152 SAT153=sat153 SAT154=sat154 SAT155=sat155 SAT156=sat156 SAT157=sat157 SAT158=sat158 SAT159=sat159 SAT160=sat160 SAT161=sat161 SAT162=sat162 SAT163=sat163 SAT164=sat164 SAT165=sat165 SAT166=sat166 SAT167=sat167 SAT168=sat168 SAT169=sat169 SAT170=sat170 PARENT=parent SLTOTAL=sltotal SLSCORE=slscore FPROTECT=fprotect MCARE=mcare FINDEP=findep MOVERPRO=moverpro FOVERPRO=foverpro FCARE=fcare MPBI7T=mpbi7t MPROTECT=mprotect MINDEP=mindep ONLYKID=onlykid SIB2T=sib2t DADTRAD=dadtrad MOMTRAD=momtrad DADWEST=dadwest MOMWEST=momwest YRSINUS=yrsinus BDIDEP=bdidep CDIDEP=cdidep OCCFT=occft OCCMOT=occmot SESCHILD=seschild EDUCMF=educmf INCOMEMF=incomemf SCSINTER=scsinter SCSINTAV=scsintav SCSINDEP=scsindep SCSINDAV=scsindav SCSTYPE=scstype PCARE=pcare ONEHIC=onehic ONEHICM=onehicm LANG54=lang54 LANG55=lang55 LANG56=lang56 LANG57=lang57 FBAVW=fbavw FAAVW=faavw FAMAVDIW=famavdiw FDIFWAB=fdifwab SBAVW=sbavw SAAVW=saavw SOCAVDIW=socavdiw SAVDIWAB=savdiwab WBAVW=wbavw WAAVW=waavw WRKAVDIW=wrkavdiw WAVDIWAB=wavdiwab CCAPAVW=ccapavw IMIGRNT=imigrnt REFUGE=refuge SETTLE=settle SOJOURN=sojourn SATTOT=sattot SATAV=satav SATFAM=satfam SATSOC=satsoc SATWRK=satwrk SATLIFE=satlife SOCSTGY=socstgy FAMSTGY=famstgy WRKSTGY=wrkstgy DLYSTGY=dlystgy IDSTGY=idstgy YRSUS=yrsus SIB1GIRL=sib1girl SIB1BOY=sib1boy SIB2GIRL=sib2girl SIB2BOY=sib2boy SIB3GIRL=sib3girl SIB3BOY=sib3boy SIB4GIRL=sib4girl SIB4BOY=sib4boy SIB5GIRL=sib5girl SIB5BOY=sib5boy SIBBOYTL=sibboytl SIBGRLTL=sibgrltl SIBTOTAL=sibtotal COLLEGEM=collegem COLLEGEF=collegef COLLEGEP=collegep MOMWORKD=momworkd MOMOCCU=momoccu DADOCCU=dadoccu WANTBOY=wantboy WANTGIRL=wantgirl BDICDI=bdicdi MFTRAD=mftrad BOTHTRAD=bothtrad MFMATCH=mfmatch MFTRADV2=mftradv2 INFLUET=influet SCSHIIND=scshiind SCSHIINT=scshiint INRELATN=inrelatn PREFENGL=prefengl DALY60AT=daly60at DALY62AT=daly62at DALY64AT=daly64at MFCGRAD=mfcgrad FAVDIFAB=favdifab SIBS=sibs CNTRYS=cntrys FAAVWT=faavwt BDIDEP2=bdidep2 SCLSOMT=sclsomt SCLSOMAV=sclsomav SOMTSCR=somtscr SOMPOS=sompos SOMCAS=somcas SCLPSYT=sclpsyt SCLPSYAV=sclpsyav PSYTSCR=psytscr PSYPOS=psypos PSYCAS=psycas SCLPART=sclpart SCLPARAV=sclparav PARTSCR=partscr PARCAS=parcas SCLPHOT=sclphot SCLPHOAV=sclphoav PHOTSCR=photscr PHOPOS=phopos PHOBCAS=phobcas SCLHOST=sclhost SCLHOSAV=sclhosav HOSTSCR=hostscr HOSPOS=hospos HOSCAS=hoscas SCLIST=sclist SCLISAV=sclisav ISTSCR=istscr ISPOS=ispos ISCAS=iscas SCLDEPT=scldept SCLDEPAV=scldepav DEPTSCR=deptscr DEPPOS=deppos DEPCAS=depcas SCLANXT=sclanxt SCLANXAV=sclanxav ANXTSCR=anxtscr ANXPOS=anxpos ANXCAS=anxcas SCLOCT=scloct SCLOCAV=sclocav OCTSCR=octscr OCPOS=ocpos OCCAS=occas SCLADDT=scladdt SCLADDAV=scladdav SCLGSI=sclgsi SCLGSIAV=sclgsiav GSI=gsi GSITSCR=gsitscr GSIPOS=gsipos GSICAS=gsicas SCLTOT=scltot SCLCAST=sclcast SCLCASE2=sclcase2 SCLPST=sclpst PSTSCR=pstscr SCLPSDI=sclpsdi PSDITSCR=psditscr SCLVLD=sclvld PSDPOS=psdpos PSTPOS=pstpos FAM1=fam1 FAM2=fam2 FAM3=fam3 FAM4=fam4 FAM5=fam5 FAM13=fam13 FAM14=fam14 FAM15=fam15 FAM16=fam16 FAM17=fam17 FAM18=fam18 FAM19=fam19 FAM20=fam20 FAM49=fam49 FAM50=fam50 FAM51=fam51 FAM52=fam52 FAM53=fam53 FAM54=fam54 FAM55=fam55 FAM56=fam56 FAM57=fam57 FAM58=fam58 FAM59=fam59 SDIFWAB=sdifwab WDIFWAB=wdifwab TDIFWAB=tdifwab DAILY38=daily38 DAILY43=daily43 WK37DIF=wk37dif WK38DIF=wk38dif WK39DIF=wk39dif WK40DIF=wk40dif WK41DIF=wk41dif WK42DIF=wk42dif WK43DIF=wk43dif WK44DIF=wk44dif WK45DIF=wk45dif WK46DIF=wk46dif WK47DIF=wk47dif WK48DIF=wk48dif WK67DIF=wk67dif WK68DIF=wk68dif WK69DIF=wk69dif WK70DIF=wk70dif WK71DIF=wk71dif WK72DIF=wk72dif WK73DIF=wk73dif WK74DIF=wk74dif WK75DIF=wk75dif SOC5=soc5 SOC6=soc6 SOC7=soc7 SOC8=soc8 SOC9=soc9 SOC10=soc10 SOC11=soc11 SOC12=soc12 SOC21=soc21 SOC22=soc22 SOC23=soc23 SOC24=soc24 SOC25=soc25 SOC26=soc26 SOC27=soc27 SOC28=soc28 SOC29=soc29 SOC30=soc30 SOC31=soc31 SOC32=soc32 SOC33=soc33 SOC34=soc34 SOC35=soc35 SOC36=soc36 SOC60=soc60 SOC61=soc61 SOC62=soc62 SOC63=soc63 SOC64=soc64 SOC65=soc65 SOC66=soc66 FAIN=fain FBIN=fbin SAIN=sain SBIN=sbin WAIN=wain WBIN=wbin DIN=din FDOMAVW=fdomavw FCBAV=fcbav FCAAV=fcaav FCAVDIF=fcavdif SDOMAVW=sdomavw SSAME=ssame SOTHER=sother WDOMAVW=wdomavw WKDIF=wkdif WKDIFNP=wkdifnp WKDIFNN=wkdifnn WKDIFTN=wkdiftn WKDIFAV=wkdifav FMDIF=fmdif FMDIFNP=fmdifnp FMDIFNN=fmdifnn FMDIFTN=fmdiftn FMDIFAV=fmdifav SCDIF=scdif CCAPDIF=ccapdif SCDIFNP=scdifnp SCDIFNN=scdifnn SCDIFTN=scdiftn SCDIFAV=scdifav CCAPTN=ccaptn CCAPDFAV=ccapdfav CCAPDNP=ccapdnp CCAPDNN=ccapdnn WK67POS=wk67pos WK68POS=wk68pos WK69POS=wk69pos WK70POS=wk70pos WK71POS=wk71pos WK73POS=wk73pos WK74POS=wk74pos WK75POS=wk75pos WK67NEG=wk67neg WK68NEG=wk68neg WK69NEG=wk69neg WK70NEG=wk70neg WK71NEG=wk71neg WK73NEG=wk73neg WK74NEG=wk74neg WK75NEG=wk75neg WKDIFMP=wkdifmp WKDIFMN=wkdifmn FAM1POS=fam1pos FAM2POS=fam2pos FAM3POS=fam3pos FAM4POS=fam4pos FAM49POS=fam49pos FAM50POS=fam50pos FAM51POS=fam51pos FAM52POS=fam52pos FAM53POS=fam53pos FAM54POS=fam54pos FAM55POS=fam55pos FAM1NEG=fam1neg FAM2NEG=fam2neg FAM3NEG=fam3neg FAM4NEG=fam4neg FAM49NEG=fam49neg FAM50NEG=fam50neg FAM51NEG=fam51neg FAM52NEG=fam52neg FAM53NEG=fam53neg FAM54NEG=fam54neg FAM55NEG=fam55neg FMDIFMP=fmdifmp FMDIFMN=fmdifmn SOC5POS=soc5pos SOC6POS=soc6pos SOC7POS=soc7pos SOC8POS=soc8pos SOC60POS=soc60pos SOC61POS=soc61pos SOC62POS=soc62pos SOC63POS=soc63pos SOC64POS=soc64pos SOC65POS=soc65pos SOC66POS=soc66pos SOC5NEG=soc5neg SOC6NEG=soc6neg SOC7NEG=soc7neg SOC8NEG=soc8neg SOC60NEG=soc60neg SOC61NEG=soc61neg SOC62NEG=soc62neg SOC63NEG=soc63neg SOC64NEG=soc64neg SOC65NEG=soc65neg SOC66NEG=soc66neg SCDIFMP=scdifmp SCDIFMN=scdifmn FSBDIF=fsbdif FWBDIF=fwbdif SWBDIF=swbdif FSADIF=fsadif FWADIF=fwadif SWADIF=swadif WKDIFMT=wkdifmt FMDIFMT=fmdifmt SCDIFMT=scdifmt CCAPDFMT=ccapdfmt ANOVA=anova CCAPDFMP=ccapdfmp CCAPDFMN=ccapdfmn BKS=bks TV=tv MOVIE=movie RADIO=radio REST=rest EAT=eat NEWS=news DLYAV1=dlyav1 DLYAV=dlyav WKDIFMAV=wkdifmav FMDIFMAV=fmdifmav SCDIFMAV=scdifmav CCAPDFTN=ccapdftn CCAPDFMV=ccapdfmv WKDIF2NP=wkdif2np WKDIF2NN=wkdif2nn WKDIF2TN=wkdif2tn FMDIF2NP=fmdif2np FMDIF2NN=fmdif2nn FMDIF2TN=fmdif2tn SCDIF2NP=scdif2np SCDIF2NN=scdif2nn SCDIF2TN=scdif2tn USYRS=usyrs POSSOM=possom POSOC=posoc POSIS=posis POSDEP=posdep POSANX=posanx POSHOS=poshos POSPHOB=posphob POSPAR=pospar POSPSY=pospsy POSGSI=posgsi POSPST=pospst POSPSDI=pospsdi WESTERN=western IMTOT=imtot MISSIIP=missiip ANGRBTOT=angrbtot ANGRBAVE=angrbave ANGRATOT=angratot ANGRAAVE=angraave ANGRTOT=angrtot ANGRTAVE=angrtave ANGRFTOT=angrftot ANGRFAVE=angrfave ANGRPUBT=angrpubt ANGRPUBA=angrpuba ANGRFPDF=angrfpdf PRIDBTOT=pridbtot PRIDBAVE=pridbave PRIDATOT=pridatot PRIDAAVE=pridaave PRIDTOT=pridtot PRIDAVE=pridave SHAMBT=shambt SHAMBAVE=shambave SHAMAT=shamat SHAMAAVE=shamaave SHAMT=shamt SHAMAVE=shamave HUMBT=humbt HUMBAVE=humbave HUMAT=humat HUMAAVE=humaave EMOTACT=emotact EMOTAAVE=emotaave ACCULTLV=accultlv SAT151T=sat151t SAT152T=sat152t SAT153T=sat153t SAT154T=sat154t SAT155T=sat155t SAT156T=sat156t SAT157T=sat157t SAT158T=sat158t SAT159T=sat159t SAT160T=sat160t SAT161T=sat161t SAT162T=sat162t SAT163T=sat163t SAT164T=sat164t SAT165T=sat165t SAT166T=sat166t SAT167T=sat167t SAT168T=sat168t SAT169T=sat169t SAT170T=sat170t FAMSAT=famsat SOCSAT=socsat FAMSAVE=famsave SOCSAVE=socsave WORKSAT=worksat WORKSAV=worksav GENSAT=gensat GENAVE=genave INCOMCAT=incomcat MARCAT=marcat HILOIDAV=hiloidav HILOITAV=hiloitav BERRY=berry WHILOID=whiloid WHILOIT=whiloit INDINTDF=indintdf PARSTY=parsty PC$BELIE=pc$belie PC$BEHAV=pc$behav PCLIVBEL=pclivbel PCLIVBEH=pclivbeh BBFINANC=bbfinanc BBTAKEIN=bbtakein BBCONFLT=bbconflt PCCONFLT=pcconflt FAMILYSA=familysa RESID$=resid$ RESIDHOM=residhom BELHOME=belhome BEL$=bel$ BEH$=beh$ BEHHOME=behhome BERRZ=berrz SCSDFCAT=scsdfcat BILINGU=bilingu BILINGS=bilings BILTRUE=biltrue CDISUIC=cdisuic WESTSUIC=westsuic TOTSUIC=totsuic SLASIAGR=slasiagr CBAPTOTL=cbaptotl CBELTOTL=cbeltotl CBELAV=cbelav CBEHTOTL=cbehtotl CBEHAV=cbehav CBBPWRKT=cbbpwrkt CBBPWRKA=cbbpwrka CBPWRKBL=cbpwrkbl CBPWRKBH=cbpwrkbh CBBPSCLT=cbbpsclt CBBPSCLA=cbbpscla CBPSCLBL=cbpsclbl CBPSCLBH=cbpsclbh CBBPFAMT=cbbpfamt CBBPFAMA=cbbpfama CBPFAMBL=cbpfambl CBPFAMBH=cbpfambh DCP2_26=dcp2_26 DCP3_27=dcp3_27 DCP4_28=dcp4_28 DCP5_29=dcp5_29 DCP6_30=dcp6_30 DCP7_31=dcp7_31 DCP8_33=dcp8_33 DCP9_35=dcp9_35 DCP10_36=dcp10_36 DCP11_38=dcp11_38 DCP14_41=dcp14_41 DCP15_43=dcp15_43 DCP16_44=dcp16_44 DCP17_45=dcp17_45 DCP18_47=dcp18_47 DCP19_48=dcp19_48 DCP20_50=dcp20_50 DCP21_49=dcp21_49 LDC2_26=Ldc2_26 LDC3_27=Ldc3_27 LDC4_28=Ldc4_28 LDC5_29=Ldc5_29 LDC6_30=Ldc6_30 LDC7_31=Ldc7_31 LDC8_33=Ldc8_33 LDC9_35=Ldc9_35 LDC10_36=Ldc10_36 LDC11_38=Ldc11_38 LDC14_41=Ldc14_41 LDC15_43=Ldc15_43 LDC16_44=Ldc16_44 LDC17_45=Ldc17_45 LDC18_47=Ldc18_47 LDC19_48=Ldc19_48 LDC20_50=Ldc20_50 LDC21_49=Ldc21_49 PDC2_26=pdc2_26 PDC3_27=pdc3_27 PDC4_28=pdc4_28 PDC5_29=pdc5_29 PDC6_30=pdc6_30 PDC7_31=pdc7_31 PDC8_33=pdc8_33 PDC9_35=pdc9_35 PDC10_36=pdc10_36 PDC11_38=pdc11_38 PDC14_41=pdc14_41 PDC15_43=pdc15_43 PDC16_44=pdc16_44 PDC17_45=pdc17_45 PDC18_47=pdc18_47 PDC19_48=pdc19_48 PDC20_50=pdc20_50 PDC21_49=pdc21_49 MPBICARE=mpbicare FPBICARE=fpbicare MPBIO_P=mpbio_p FPBIO_P=fpbio_p MCAREGRP=mcaregrp FCAREGRP=fcaregrp MO_PGRP=mo_pgrp FO_PGRP=fo_pgrp MPBIGRP=Mpbigrp FPBIGRP=fpbigrp CAREGRP=caregrp O_PGRP=o_pgrp PBIOPTGR=pbioptgr PBIACGR=pbiacgreedede i@Mb?edddddddffdfdeddfdodddddddddddddddddddeedeeeheff8@feej8@8@8@8@feej8@8@8@8@dedddd8@8@gggeeeedeedddd8@8@edih8@8@8@d8@8@8@8@8@8@8@hfdf8@8@8@8@edd8@8@8@8@8@de8@8@8@8@8@8@eeef8@8@8@8@efef8@8@8@8@ee8@8@8@8@8@8@ee8@8@8@8@8@8@ee8@8@8@8@8@8@ee8@8@8@8@8@8@ee8@8@8@8@8@8@efej8@8@8@8@ejejejj8@efefegffeeeeeeefefdddfddddfdddeddfdddfeeeddededdedddddeeddeedeeefdddegeefgfffffeefdeeeeeeefgeffddfeffeegfdeeffeeeeeffgefegefefefdeefegffgeffggfeeedgfeffdegeedfeedfdffeffeeffgffefeeedgeffefeeeffediggggjjjijgjjjghiiggijiggijiggiiiiigiihiiiiffhgghggffhgghggffhgghggggghhhgghgggihhhgggfhgihghhghihghgfghhfhhhhghhghhhghggggghghggggghghghggggghhghhggggggghihihffhhhighgghgighggfihhfggffgffffgffffffffffdynjoxdqkdeddddddjj|ppd""""""@""""""@jjjjF]tE@.袋@@]tE?@]tE?@ @TUUUUU? @ @d? @ff@@@8@8@8@jededd8@8@eddddefgeddddedddegeddeeebbceddecdecdcceebdcdiiccTUUUUU??<>?dddeddedddeceddbddddeeeeeefbceddecdbcdddeddeceecede8@8@8@8@8@e颋.@ @@wwwwww@@@gefgeoh @jnm{fkm?ezksede袋.?ddddddcddddddfceeededdddeedddbdcdccddj_deeeedeededdddddcddcddkbV(nֿgom]tE?DDDDDD?־a?0袋.?hfffff?{gs\iiiiiiijeetE]t@?zdddede袋.?ddddd~?@88 @xiz88@@033333?UUUUUU @gqq @98 @88 @grq @rq @ @hhiihiiiihiiiiiiiiiiz|@}i}iffe333333@egdddefdfeefiqM5hgeb3eedf@/袋.@^B{ @ @ @$I$I @hhd@UUUUUU @@.袋@eeeecceeedeceddddddddddddddddddddddddddddddddddddddddrweedeefehfee@i@Q?eefgededeedeeeeeeegfdzeddedgeeddededfdedddeq8@eeegefe8@8@8@egieee8@8@ided8@8@8@8@dddfeifiededd8@8@8@eddfed8@8@je|hh8@8@8@dikdf8@8@8@feg8@8@8@8@8@edededddddiif8@8@8@efef8@8@8@8@ff8@8@8@8@8@8@fe8@8@8@8@8@8@ef8@8@8@8@8@8@ef8@8@8@8@8@8@ef8@8@8@8@8@8@ef8@8@8@8@8@8@efgeffffifiefeeefgeeiiifififidddfddddefddfddfddddddeddfffgggfgedggefgfeffggfefgfddfededdefddddfdedddddefeedggdedddedeedgeddddddgggdeghghgggghhddgddfhggghhfhdgfgghdgfgggggfgegfdeggefeefedfgdhhhededdeffffeeeffefggfgfgggfeefefffffedefeefdgeffedeeeddfdeedheeeffeeeeddeefdeedeggeffeeffgheeefegfheeifhgejkhihkjigkjjikkikhieijihhkkkfifgghggghgghhhgfgghighhghhgggghgghghghggffgfiiihhigghfeeeeggigffffggggffghgifghhihgghhhhhgghhhhgggghhhhgggggghhhhffffffiiiiiiihhijeeeeghghghhgffhhhhhffgfggiiihihijjjiijjhiido<?ddddi@颋.@^B{ @UUUUUU @ @n۶m۶ @@@feeUUUUUU@xxxxxx@ @/袋.@dccccceddcdcdddddddddddddddddddddeddddddddddddddddd}utpddedhghehfeeedi@ˡE?eeedfeeedeedddddeefrdddedddddddeddeeeeddedk~eeefeffeg8@8@8@8@ifegi8@8@8@deddd8@8@8@defgfge8@eeddd8@8@8@dffdhe8@8@|hfd8@8@8@8@fgefefe8@ddddeeeeeededddehhfef8@8@8@eff8@8@8@8@8@ff8@8@8@8@8@8@fef8@8@8@8@8@ff8@8@8@8@8@8@ff8@8@8@8@8@8@ff8@8@8@8@8@8@ff8@8@8@8@8@8@fgfffffifeeffeegffgfgfgfffgdddddddddedddddddddeddeddeefeegffeeffeeefgggfgggggffeeeeeeeeeeeeegfefeeeeeeeeeeeefeeeeeeefefeeeeeeefeffeeeeeeeeeeeffedeeeeeeeeeeeeedeeeeeeeeeeeeeeefeefeeeeedeeeeefffeddeeeeeeeeeeeeeedeeeeeeeeeeeedeeffeeeeeeeeeeddeeeeeeeeeeeeeedfdeeeeeeeeeeedefffffeeeeggeeeeeffefehhgfegfjijjjijiiihjhjjhjgijhhiijihihiihfihihiiiiihhhffffhhiiggffhhhiggffghhhhhgggfffhghhgffg8@ghghfg8@8@fgiggfgiifhhgghihhhgghiiffffiiiifgffiihhhhgfggghghhhgggfffgighhffiig8@8@8@8@iigghhgfgghifffffgggfggffffgggffgdsiI$I$?n|emddddfddhhvnlgUUUUUU@@eeeeE]t @h颋. @@]tE?@]tE?wwwwww@  @edde @? @e@@ffffff@@@8@feddd8@8@8@dddddddeedeeddeddedmmmefre?eleek??eleek$I$I?eemee?enddneى؉?eeneedgee۶m۶m?333333!@?>?5@͠?kee333333?deeeefedcffddaaebedcddeed ??ĭP ?dedddddddddcedecdeddecedeffeccgfeeaadddedeccbcdcadc8@8@8@8@8@fg8@]tE] @8@ @@ifgien